PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.E00056.1.p
Common NameLOC105974807, MIMGU_mgv1a009929mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 328aa    MW: 35212.4 Da    PI: 6.7162
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.E00056.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.31.6e-33164221259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers+edp+vv++tYeg+H h+
  Migut.E00056.1.p 164 EDGYRWRKYGQKAVKNSPFPRSYYRCTNSKCTVKKRVERSSEDPTVVITTYEGQHSHH 221
                       8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.9E-34148222IPR003657WRKY domain
SuperFamilySSF1182901.57E-28155222IPR003657WRKY domain
PROSITE profilePS5081130.285158223IPR003657WRKY domain
SMARTSM007741.4E-38163222IPR003657WRKY domain
PfamPF031062.1E-26164221IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MDGKKKAEDP EFTTESSWGL GGDVNHGYFF GSGTDDYRES SVLTDFGWNI PSESNGVWGS  60
DLAGSGADGC VSVATSGIST APPPQPMALV DQENNTFASN PSVSSSSSED LGDKSTASGG  120
SSSAAAVNPT PSSDTASKAK KKGEKRLRQP RFAFVTKSEI DHLEDGYRWR KYGQKAVKNS  180
PFPRSYYRCT NSKCTVKKRV ERSSEDPTVV ITTYEGQHSH HSSSSSSVGF PCRSGGGGLL  240
PQLQLEPDST FSRNASSNNI NNSHDFSYYP RPPLQLTTQE NCDSIINNKE LPPSKNQLGK  300
DGELSHQGKE TTSQGLLGDI VPPRMRH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-261562201074Probable WRKY transcription factor 4
2lex_A4e-261562201074Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBMTransfer from AT1G69310Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012855421.10.0PREDICTED: probable WRKY transcription factor 57
TrEMBLA0A022Q4100.0A0A022Q410_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA80312228
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.22e-48WRKY DNA-binding protein 57